Compile Data Set for Download or QSAR

Found 190 hits with Last Name = 'weller' and Initial = 'jm'   

Target/Host (Institution)	Ligand	Target/Host Links	Ligand Links	Trg + Lig Links	Ki nM	ΔG° kJ/mole	IC50 nM	Kd nM	EC50/IC50 nM	koff s-1	kon M-1s-1	pH	Temp °C
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233283 (CHEMBL4102262) Show SMILES OC(=O)c1ccc(Cl)cc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H30ClF3N2O3/c28-21-8-11-23(26(35)36)19(16-21)5-4-17-2-1-3-24(17)32-25(34)18-12-14-33(15-13-18)22-9-6-20(7-10-22)27(29,30)31/h6-11,16-18,24H,1-5,12-15H2,(H,32,34)(H,35,36)/t17-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233285 (CHEMBL4101413) Show SMILES Cc1cccc2ccc(nc12)N1CCC(CC1)C(=O)N[C@H]1CCC[C@H]1CCc1ccccc1C(O)=O |r| Show InChI InChI=1S/C30H35N3O3/c1-20-6-4-9-23-14-15-27(32-28(20)23)33-18-16-24(17-19-33)29(34)31-26-11-5-8-22(26)13-12-21-7-2-3-10-25(21)30(35)36/h2-4,6-7,9-10,14-15,22,24,26H,5,8,11-13,16-19H2,1H3,(H,31,34)(H,35,36)/t22-,26-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair				3D Structure (crystal)
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233277 (CHEMBL4085873) Show SMILES Cc1ccc(C(O)=O)c(CC[C@@H]2CCC[C@@H]2NC(=O)C2CCN(CC2)c2ccc(cc2)C(F)(F)F)c1 |r| Show InChI InChI=1S/C28H33F3N2O3/c1-18-5-12-24(27(35)36)21(17-18)7-6-19-3-2-4-25(19)32-26(34)20-13-15-33(16-14-20)23-10-8-22(9-11-23)28(29,30)31/h5,8-12,17,19-20,25H,2-4,6-7,13-16H2,1H3,(H,32,34)(H,35,36)/t19-,25-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233281 (CHEMBL4084995) Show SMILES OC(=O)c1ccccc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(OC(F)(F)F)cc1 |r| Show InChI InChI=1S/C27H31F3N2O4/c28-27(29,30)36-22-12-10-21(11-13-22)32-16-14-20(15-17-32)25(33)31-24-7-3-5-19(24)9-8-18-4-1-2-6-23(18)26(34)35/h1-2,4,6,10-13,19-20,24H,3,5,7-9,14-17H2,(H,31,33)(H,34,35)/t19-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233278 (CHEMBL4064335) Show SMILES OC(=O)c1ccc(F)cc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H30F4N2O3/c28-21-8-11-23(26(35)36)19(16-21)5-4-17-2-1-3-24(17)32-25(34)18-12-14-33(15-13-18)22-9-6-20(7-10-22)27(29,30)31/h6-11,16-18,24H,1-5,12-15H2,(H,32,34)(H,35,36)/t17-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233283 (CHEMBL4102262) Show SMILES OC(=O)c1ccc(Cl)cc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H30ClF3N2O3/c28-21-8-11-23(26(35)36)19(16-21)5-4-17-2-1-3-24(17)32-25(34)18-12-14-33(15-13-18)22-9-6-20(7-10-22)27(29,30)31/h6-11,16-18,24H,1-5,12-15H2,(H,32,34)(H,35,36)/t17-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233274 (CHEMBL4067045) Show SMILES OC(=O)c1ccc(Cl)cc1NC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccccc1 |r| Show InChI InChI=1S/C25H30ClN3O3/c26-19-9-10-21(25(31)32)23(15-19)27-16-18-5-4-8-22(18)28-24(30)17-11-13-29(14-12-17)20-6-2-1-3-7-20/h1-3,6-7,9-10,15,17-18,22,27H,4-5,8,11-14,16H2,(H,28,30)(H,31,32)/t18-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	2	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233280 (CHEMBL4063350) Show SMILES OC(=O)c1ccccc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cn1)C(F)(F)F |r| Show InChI InChI=1S/C26H30F3N3O3/c27-26(28,29)20-10-11-23(30-16-20)32-14-12-19(13-15-32)24(33)31-22-7-3-5-18(22)9-8-17-4-1-2-6-21(17)25(34)35/h1-2,4,6,10-11,16,18-19,22H,3,5,7-9,12-15H2,(H,31,33)(H,34,35)/t18-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	2	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233276 (CHEMBL4078000) Show SMILES OC(=O)c1ccc(Cl)cc1OC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H28ClF3N2O4/c27-19-6-9-21(25(34)35)23(14-19)36-15-17-2-1-3-22(17)31-24(33)16-10-12-32(13-11-16)20-7-4-18(5-8-20)26(28,29)30/h4-9,14,16-17,22H,1-3,10-13,15H2,(H,31,33)(H,34,35)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	2	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233284 (CHEMBL4071976) Show SMILES OC(=O)c1ccccc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H31F3N2O3/c28-27(29,30)21-10-12-22(13-11-21)32-16-14-20(15-17-32)25(33)31-24-7-3-5-19(24)9-8-18-4-1-2-6-23(18)26(34)35/h1-2,4,6,10-13,19-20,24H,3,5,7-9,14-17H2,(H,31,33)(H,34,35)/t19-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	2	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233277 (CHEMBL4085873) Show SMILES Cc1ccc(C(O)=O)c(CC[C@@H]2CCC[C@@H]2NC(=O)C2CCN(CC2)c2ccc(cc2)C(F)(F)F)c1 |r| Show InChI InChI=1S/C28H33F3N2O3/c1-18-5-12-24(27(35)36)21(17-18)7-6-19-3-2-4-25(19)32-26(34)20-13-15-33(16-14-20)23-10-8-22(9-11-23)28(29,30)31/h5,8-12,17,19-20,25H,2-4,6-7,13-16H2,1H3,(H,32,34)(H,35,36)/t19-,25-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233275 (CHEMBL4094518) Show SMILES OC(=O)c1ccc(Cl)cc1NC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H29ClF3N3O3/c27-19-6-9-21(25(35)36)23(14-19)31-15-17-2-1-3-22(17)32-24(34)16-10-12-33(13-11-16)20-7-4-18(5-8-20)26(28,29)30/h4-9,14,16-17,22,31H,1-3,10-13,15H2,(H,32,34)(H,35,36)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532313 (CHEMBL4436740) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-9-7-23-15(27(9)2)18(16(29)25-17(30)26-18)8-24-14(28)13-6-10-5-11(19(20,21)22)3-4-12(10)31-13/h3-7H,8H2,1-2H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50033806 (CHEMBL3358156) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C17H14ClN5O4/c1-23-5-4-19-14(23)17(15(25)21-16(26)22-17)8-20-13(24)12-7-9-6-10(18)2-3-11(9)27-12/h2-7H,8H2,1H3,(H,20,24)(H2,21,22,25,26)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	Purchase CHEMBL PC cid PC sid PDB UniChem Similars	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033806 (CHEMBL3358156) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C17H14ClN5O4/c1-23-5-4-19-14(23)17(15(25)21-16(26)22-17)8-20-13(24)12-7-9-6-10(18)2-3-11(9)27-12/h2-7H,8H2,1H3,(H,20,24)(H2,21,22,25,26)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	Purchase CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair				3D Structure (crystal)
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50033806 (CHEMBL3358156) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C17H14ClN5O4/c1-23-5-4-19-14(23)17(15(25)21-16(26)22-17)8-20-13(24)12-7-9-6-10(18)2-3-11(9)27-12/h2-7H,8H2,1H3,(H,20,24)(H2,21,22,25,26)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	Purchase CHEMBL PC cid PC sid PDB UniChem Similars	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532313 (CHEMBL4436740) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-9-7-23-15(27(9)2)18(16(29)25-17(30)26-18)8-24-14(28)13-6-10-5-11(19(20,21)22)3-4-12(10)31-13/h3-7H,8H2,1-2H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033806 (CHEMBL3358156) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C17H14ClN5O4/c1-23-5-4-19-14(23)17(15(25)21-16(26)22-17)8-20-13(24)12-7-9-6-10(18)2-3-11(9)27-12/h2-7H,8H2,1H3,(H,20,24)(H2,21,22,25,26)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	Purchase CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	3	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair				3D Structure (crystal)
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233275 (CHEMBL4094518) Show SMILES OC(=O)c1ccc(Cl)cc1NC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H29ClF3N3O3/c27-19-6-9-21(25(35)36)23(14-19)31-15-17-2-1-3-22(17)32-24(34)16-10-12-33(13-11-16)20-7-4-18(5-8-20)26(28,29)30/h4-9,14,16-17,22,31H,1-3,10-13,15H2,(H,32,34)(H,35,36)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	3.5	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human A549 cells assessed as reduction in IL-1beta-induced PGE2 production preincubated for 30 mins followed by IL-1beta addi...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233275 (CHEMBL4094518) Show SMILES OC(=O)c1ccc(Cl)cc1NC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H29ClF3N3O3/c27-19-6-9-21(25(35)36)23(14-19)31-15-17-2-1-3-22(17)32-24(34)16-10-12-33(13-11-16)20-7-4-18(5-8-20)26(28,29)30/h4-9,14,16-17,22,31H,1-3,10-13,15H2,(H,32,34)(H,35,36)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033808 (CHEMBL3358158) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H14F3N5O4/c1-26-5-4-22-14(26)17(15(28)24-16(29)25-17)8-23-13(27)12-7-9-6-10(18(19,20)21)2-3-11(9)30-12/h2-7H,8H2,1H3,(H,23,27)(H2,24,25,28,29)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532312 (CHEMBL4450729) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50033808 (CHEMBL3358158) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H14F3N5O4/c1-26-5-4-22-14(26)17(15(28)24-16(29)25-17)8-23-13(27)12-7-9-6-10(18(19,20)21)2-3-11(9)30-12/h2-7H,8H2,1H3,(H,23,27)(H2,24,25,28,29)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532312 (CHEMBL4450729) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033808 (CHEMBL3358158) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H14F3N5O4/c1-26-5-4-22-14(26)17(15(28)24-16(29)25-17)8-23-13(27)12-7-9-6-10(18(19,20)21)2-3-11(9)30-12/h2-7H,8H2,1H3,(H,23,27)(H2,24,25,28,29)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532312 (CHEMBL4450729) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50033808 (CHEMBL3358158) Show SMILES Cn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H14F3N5O4/c1-26-5-4-22-14(26)17(15(28)24-16(29)25-17)8-23-13(27)12-7-9-6-10(18(19,20)21)2-3-11(9)30-12/h2-7H,8H2,1H3,(H,23,27)(H2,24,25,28,29)/t17-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532312 (CHEMBL4450729) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532313 (CHEMBL4436740) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-9-7-23-15(27(9)2)18(16(29)25-17(30)26-18)8-24-14(28)13-6-10-5-11(19(20,21)22)3-4-12(10)31-13/h3-7H,8H2,1-2H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532313 (CHEMBL4436740) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-9-7-23-15(27(9)2)18(16(29)25-17(30)26-18)8-24-14(28)13-6-10-5-11(19(20,21)22)3-4-12(10)31-13/h3-7H,8H2,1-2H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	4	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50238243 (CHEMBL4097165) Show SMILES FC(F)(F)c1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r| Show InChI InChI=1S/C17H14F3N3O4/c18-17(19,20)10-3-4-11-8(5-10)6-12(27-11)13(24)21-7-16(9-1-2-9)14(25)22-15(26)23-16/h3-6,9H,1-2,7H2,(H,21,24)(H2,22,23,25,26)/t16-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Patents Similars	Article PubMed	n/a	n/a	5	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50238243 (CHEMBL4097165) Show SMILES FC(F)(F)c1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r| Show InChI InChI=1S/C17H14F3N3O4/c18-17(19,20)10-3-4-11-8(5-10)6-12(27-11)13(24)21-7-16(9-1-2-9)14(25)22-15(26)23-16/h3-6,9H,1-2,7H2,(H,21,24)(H2,22,23,25,26)/t16-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Patents Similars	Article PubMed	n/a	n/a	5	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233284 (CHEMBL4071976) Show SMILES OC(=O)c1ccccc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H31F3N2O3/c28-27(29,30)21-10-12-22(13-11-21)32-16-14-20(15-17-32)25(33)31-24-7-3-5-19(24)9-8-18-4-1-2-6-23(18)26(34)35/h1-2,4,6,10-13,19-20,24H,3,5,7-9,14-17H2,(H,31,33)(H,34,35)/t19-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	5	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233279 (CHEMBL4092750) Show SMILES OC(=O)c1cccnc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H30F3N3O3/c27-26(28,29)19-7-9-20(10-8-19)32-15-12-18(13-16-32)24(33)31-22-5-1-3-17(22)6-11-23-21(25(34)35)4-2-14-30-23/h2,4,7-10,14,17-18,22H,1,3,5-6,11-13,15-16H2,(H,31,33)(H,34,35)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of human mPGES1 expressed in HEK293 microsomes assessed as reduction in PGE2 production using PGH2 as substrate after 2.5 mins by LC-MS an...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50238243 (CHEMBL4097165) Show SMILES FC(F)(F)c1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r| Show InChI InChI=1S/C17H14F3N3O4/c18-17(19,20)10-3-4-11-8(5-10)6-12(27-11)13(24)21-7-16(9-1-2-9)14(25)22-15(26)23-16/h3-6,9H,1-2,7H2,(H,21,24)(H2,22,23,25,26)/t16-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Patents Similars	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532311 (CHEMBL4587825) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-9-7-20-15(24(9)2)18(16(26)22-17(27)23-18)8-21-14(25)13-6-10-5-11(19)3-4-12(10)28-13/h3-7H,8H2,1-2H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50238243 (CHEMBL4097165) Show SMILES FC(F)(F)c1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r| Show InChI InChI=1S/C17H14F3N3O4/c18-17(19,20)10-3-4-11-8(5-10)6-12(27-11)13(24)21-7-16(9-1-2-9)14(25)22-15(26)23-16/h3-6,9H,1-2,7H2,(H,21,24)(H2,22,23,25,26)/t16-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Patents Similars	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532311 (CHEMBL4587825) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-9-7-20-15(24(9)2)18(16(26)22-17(27)23-18)8-21-14(25)13-6-10-5-11(19)3-4-12(10)28-13/h3-7H,8H2,1-2H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233278 (CHEMBL4064335) Show SMILES OC(=O)c1ccc(F)cc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C27H30F4N2O3/c28-21-8-11-23(26(35)36)19(16-21)5-4-17-2-1-3-24(17)32-25(34)18-12-14-33(15-13-18)22-9-6-20(7-10-22)27(29,30)31/h6-11,16-18,24H,1-5,12-15H2,(H,32,34)(H,35,36)/t17-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233285 (CHEMBL4101413) Show SMILES Cc1cccc2ccc(nc12)N1CCC(CC1)C(=O)N[C@H]1CCC[C@H]1CCc1ccccc1C(O)=O |r| Show InChI InChI=1S/C30H35N3O3/c1-20-6-4-9-23-14-15-27(32-28(20)23)33-18-16-24(17-19-33)29(34)31-26-11-5-8-22(26)13-12-21-7-2-3-10-25(21)30(35)36/h2-4,6-7,9-10,14-15,22,24,26H,5,8,11-13,16-19H2,1H3,(H,31,34)(H,35,36)/t22-,26-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair				3D Structure (crystal)
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532311 (CHEMBL4587825) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-9-7-20-15(24(9)2)18(16(26)22-17(27)23-18)8-21-14(25)13-6-10-5-11(19)3-4-12(10)28-13/h3-7H,8H2,1-2H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	7	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532311 (CHEMBL4587825) Show SMILES Cc1cnc(n1C)[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-9-7-20-15(24(9)2)18(16(26)22-17(27)23-18)8-21-14(25)13-6-10-5-11(19)3-4-12(10)28-13/h3-7H,8H2,1-2H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	7	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532310 (CHEMBL4589438) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-2-24-6-5-20-15(24)18(16(26)22-17(27)23-18)9-21-14(25)13-8-10-7-11(19)3-4-12(10)28-13/h3-8H,2,9H2,1H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233276 (CHEMBL4078000) Show SMILES OC(=O)c1ccc(Cl)cc1OC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| Show InChI InChI=1S/C26H28ClF3N2O4/c27-19-6-9-21(25(34)35)23(14-19)36-15-17-2-1-3-22(17)31-24(33)16-10-12-32(13-11-16)20-7-4-18(5-8-20)26(28,29)30/h4-9,14,16-17,22H,1-3,10-13,15H2,(H,31,33)(H,34,35)/t17-,22-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033805 (CHEMBL3358155) Show SMILES Clc1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)c1nccs1 |r| Show InChI InChI=1S/C16H11ClN4O4S/c17-9-1-2-10-8(5-9)6-11(25-10)12(22)19-7-16(14-18-3-4-26-14)13(23)20-15(24)21-16/h1-6H,7H2,(H,19,22)(H2,20,21,23,24)/t16-/m1/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair				3D Structure (crystal)
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50033805 (CHEMBL3358155) Show SMILES Clc1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)c1nccs1 |r| Show InChI InChI=1S/C16H11ClN4O4S/c17-9-1-2-10-8(5-9)6-11(25-10)12(22)19-7-16(14-18-3-4-26-14)13(23)20-15(24)21-16/h1-6H,7H2,(H,19,22)(H2,20,21,23,24)/t16-/m1/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid PDB UniChem Similars	PDB Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair				3D Structure (crystal)
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human))	BDBM50532310 (CHEMBL4589438) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-2-24-6-5-20-15(24)18(16(26)22-17(27)23-18)9-21-14(25)13-8-10-7-11(19)3-4-12(10)28-13/h3-8H,2,9H2,1H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532310 (CHEMBL4589438) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-2-24-6-5-20-15(24)18(16(26)22-17(27)23-18)9-21-14(25)13-8-10-7-11(19)3-4-12(10)28-13/h3-8H,2,9H2,1H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	9	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (Homo sapiens (Human))	BDBM50532310 (CHEMBL4589438) Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(Cl)ccc3o2)NC(=O)NC1=O |r| Show InChI InChI=1S/C18H16ClN5O4/c1-2-24-6-5-20-15(24)18(16(26)22-17(27)23-18)9-21-14(25)13-8-10-7-11(19)3-4-12(10)28-13/h3-8H,2,9H2,1H3,(H,21,25)(H2,22,23,26,27)/t18-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	9	n/a	n/a	n/a	n/a	n/a	n/a
Eli Lilly and Company Curated by ChEMBL					Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay				J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T
					More data for this Ligand-Target Pair
Prostaglandin E synthase (Homo sapiens (Human))	BDBM50233281 (CHEMBL4084995) Show SMILES OC(=O)c1ccccc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(OC(F)(F)F)cc1 |r| Show InChI InChI=1S/C27H31F3N2O4/c28-27(29,30)36-22-12-10-21(11-13-22)32-16-14-20(15-17-32)25(33)31-24-7-3-5-19(24)9-8-18-4-1-2-6-23(18)26(34)35/h1-2,4,6,10-13,19-20,24H,3,5,7-9,14-17H2,(H,31,33)(H,34,35)/t19-,24-/m0/s1	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem Similars	Article PubMed	n/a	n/a	10	n/a	n/a	n/a	n/a	n/a	n/a
Lilly Research Laboratories Curated by ChEMBL					Assay Description Inhibition of mPGES1 in human whole blood assessed as reduction in LPS-induced PGE2 production preincubated for 30 mins followed by LPS addition meas...				Bioorg Med Chem Lett 27: 1478-1483 (2017) Article DOI: 10.1016/j.bmcl.2016.11.011 BindingDB Entry DOI: 10.7270/Q28P62RZ
					More data for this Ligand-Target Pair

Displayed 1 to 50 (of 190 total )  |  Next  |  Last  >>

Jump to: