Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kcal/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557751![]() (CHEMBL4792978) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 180 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557745![]() (CHEMBL4741913) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 190 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557742![]() (CHEMBL4752199) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 310 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557760![]() (CHEMBL4749011) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 530 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557743![]() (CHEMBL4744988) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 630 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557744![]() (CHEMBL4741185) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 700 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557762![]() (CHEMBL4747422) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 800 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557763![]() (CHEMBL4744618) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 860 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557752![]() (CHEMBL4763122) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 960 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557747![]() (CHEMBL4795223) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557741![]() (CHEMBL4750258) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557739![]() (CHEMBL4798505) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557746![]() (CHEMBL4779579) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557749![]() (CHEMBL4783244) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557756![]() (CHEMBL4779273) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 1.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557765![]() (CHEMBL4791414) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557761![]() (CHEMBL4758580) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50466183![]() (CHEMBL4283638) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | Purchase MCE PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.37E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
National Center for Advancing Translational Sciences Curated by ChEMBL | Assay Description Inhibition of full length GST-tagged human ACVR2A expressed in Baculovirus expression system by LanthaScreen assay | Bioorg Med Chem Lett 28: 3356-3362 (2018) Article DOI: 10.1016/j.bmcl.2018.09.006 BindingDB Entry DOI: 10.7270/Q2NZ8BBT | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557764![]() (CHEMBL4787891) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.40E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557754![]() (CHEMBL4764416) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.70E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557767![]() (CHEMBL4764221) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557755![]() (CHEMBL4782729) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557759![]() (CHEMBL4763627) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 3.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557766![]() (CHEMBL4751832) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 3.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557740![]() (CHEMBL4777071) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 3.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557753![]() (CHEMBL4748097) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 3.80E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557757![]() (CHEMBL4792464) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid PDB UniChem | Article PubMed | n/a | n/a | 4.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557758![]() (CHEMBL4749061) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 5.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50401152![]() (CHEMBL2205766) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | n/a | n/a | <1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Cellzome Ltd Curated by ChEMBL | Assay Description Inhibition of ACVR2A | Bioorg Med Chem Lett 22: 4613-8 (2012) Article DOI: 10.1016/j.bmcl.2012.05.090 BindingDB Entry DOI: 10.7270/Q2HQ412B | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557750![]() (CHEMBL4747912) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 2.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Activin receptor type-2A (Homo sapiens (Human)) | BDBM50557748![]() (CHEMBL4745367) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet ![]() | PC cid PC sid UniChem | Article PubMed | n/a | n/a | >2.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20... | Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5 | |||||||||||
More data for this Ligand-Target Pair |