Compile Data Set for Download or QSAR

Found 73 hits Enz. Inhib. hit(s) with all data for entry = 50012455   

Target/Host (Institution)	Ligand	Target/Host Links	Ligand Links	Trg + Lig Links	Ki nM	ΔG° kJ/mole	IC50 nM	Kd nM	EC50/IC50 nM	koff s-1	kon M-1s-1	pH	Temp °C
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557765 (CHEMBL4791414) Show SMILES Cn1cc(cn1)-c1nc2c(cnn2cc1OCC(C)(C)O)-c1ccnc(OC2CC2)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	0.310	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557761 (CHEMBL4758580) Show SMILES COc1cn2ncc(-c3ccnc(OC(C)C)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	0.560	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557764 (CHEMBL4787891) Show SMILES COc1cn2ncc(-c3ccnc(OC4CCC4)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	0.610	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557766 (CHEMBL4751832) Show SMILES Cn1cc(cn1)-c1nc2c(cnn2cc1OCCC(C)(C)O)-c1ccnc(OC2CC2)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	0.830	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557742 (CHEMBL4752199) Show SMILES CNc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557760 (CHEMBL4749011) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)-c1cnn(C)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	<1	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557753 (CHEMBL4748097) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)C(C)C Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557756 (CHEMBL4779273) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)C1CCOC1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.10	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557755 (CHEMBL4782729) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)C1CCCC1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.20	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557744 (CHEMBL4741185) Show SMILES CCc1cn2ncc(-c3ccnc(OC)c3)c2nc1NC Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.5	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557763 (CHEMBL4744618) Show SMILES COc1cn2ncc(-c3ccnc(OC4CC4)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.60	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557767 (CHEMBL4764221) Show SMILES Cn1cc(cn1)-c1nc2c(cnn2cc1OCCCC(C)(C)O)-c1ccnc(OC2CC2)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	2	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557759 (CHEMBL4763627) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)-c1cc(C)no1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	2.90	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557746 (CHEMBL4779579) Show SMILES CNc1nc2c(cnn2cc1C)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	2.90	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557757 (CHEMBL4792464) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)[C@H]1COC(C)(C)C1 |r| Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid PDB UniChem	PDB Article PubMed	n/a	n/a	<3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair				3D Structure (crystal)
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557745 (CHEMBL4741913) Show SMILES CNc1nc2c(cnn2cc1C=C)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	<3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557754 (CHEMBL4764416) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)C(C)(C)O Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3.30	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557758 (CHEMBL4749061) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)[C@@H]1COC(C)(C)C1 |r| Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3.60	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557743 (CHEMBL4744988) Show SMILES CNc1nc2c(cnn2cc1C1CC1)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3.70	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557747 (CHEMBL4795223) Show SMILES CNc1ccn2ncc(-c3ccnc(OC)c3)c2n1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	3.90	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557739 (CHEMBL4798505) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(C)nc12 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	5	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557762 (CHEMBL4747422) Show SMILES COc1cn2ncc(-c3ccnc(OC(C)(C)C)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	7	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557740 (CHEMBL4777071) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)N(C)C Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	7.90	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557741 (CHEMBL4750258) Show SMILES COc1cnc2c(cnn2c1)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	15	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-1 (Homo sapiens (Human))	BDBM50557768 (CHEMBL4752410) Show SMILES O=C(Nc1ccccc1)c1ccc(cc1)-c1cc(ccn1)-c1c[nH]nc1-c1ccccn1 Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	18	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557752 (CHEMBL4763122) Show SMILES CCc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	36	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557749 (CHEMBL4783244) Show SMILES C1COCCOc2cccc(c2)-c2cnn3ccc(N1)nc23 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	75	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557750 (CHEMBL4747912) Show SMILES COc1cc(CNC(=O)Nc2snc(OCc3cccnc3)c2C(N)=O)cc(OC)c1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	110	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557751 (CHEMBL4792978) Show SMILES Cc1ccc(cc1)-c1cnc(N)c(n1)C(=O)NC1CCCCC1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	180	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557745 (CHEMBL4741913) Show SMILES CNc1nc2c(cnn2cc1C=C)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	190	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557742 (CHEMBL4752199) Show SMILES CNc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	310	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557751 (CHEMBL4792978) Show SMILES Cc1ccc(cc1)-c1cnc(N)c(n1)C(=O)NC1CCCCC1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	490	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557760 (CHEMBL4749011) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)-c1cnn(C)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	530	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557743 (CHEMBL4744988) Show SMILES CNc1nc2c(cnn2cc1C1CC1)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	630	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557744 (CHEMBL4741185) Show SMILES CCc1cn2ncc(-c3ccnc(OC)c3)c2nc1NC Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	700	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-1 (Homo sapiens (Human))	BDBM50557742 (CHEMBL4752199) Show SMILES CNc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1 Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	710	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557762 (CHEMBL4747422) Show SMILES COc1cn2ncc(-c3ccnc(OC(C)(C)C)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	800	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557763 (CHEMBL4744618) Show SMILES COc1cn2ncc(-c3ccnc(OC4CC4)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	860	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557752 (CHEMBL4763122) Show SMILES CCc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	960	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-2 (Homo sapiens (Human))	BDBM50557748 (CHEMBL4745367) Show SMILES CNc1ccn2ncc(-c3cccc(OC)c3)c2n1 Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt UniProtKB/TrEMBL B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.00E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557747 (CHEMBL4795223) Show SMILES CNc1ccn2ncc(-c3ccnc(OC)c3)c2n1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.10E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557739 (CHEMBL4798505) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(C)nc12 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.20E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557741 (CHEMBL4750258) Show SMILES COc1cnc2c(cnn2c1)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.20E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557749 (CHEMBL4783244) Show SMILES C1COCCOc2cccc(c2)-c2cnn3ccc(N1)nc23 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.30E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557746 (CHEMBL4779579) Show SMILES CNc1nc2c(cnn2cc1C)-c1ccnc(OC)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.30E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-1 (Homo sapiens (Human))	BDBM50557745 (CHEMBL4741913) Show SMILES CNc1nc2c(cnn2cc1C=C)-c1ccnc(OC)c1 Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.40E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-1 (Homo sapiens (Human))	BDBM50557744 (CHEMBL4741185) Show SMILES CCc1cn2ncc(-c3ccnc(OC)c3)c2nc1NC Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.90E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557756 (CHEMBL4779273) Show SMILES COc1cc(ccn1)-c1cnn2cc(OC)c(nc12)C1CCOC1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.90E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
TGF-beta receptor type-1 (Homo sapiens (Human))	BDBM50557746 (CHEMBL4779579) Show SMILES CNc1nc2c(cnn2cc1C)-c1ccnc(OC)c1 Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	2.00E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 min				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair
Activin receptor type-2A (Homo sapiens (Human))	BDBM50557761 (CHEMBL4758580) Show SMILES COc1cn2ncc(-c3ccnc(OC(C)C)c3)c2nc1-c1cnn(C)c1 Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	2.30E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...				Citation and Details Article DOI: 10.1021/acsmedchemlett.0c00679 BindingDB Entry DOI: 10.7270/Q2PG1WD5
					More data for this Ligand-Target Pair

Displayed 1 to 50 (of 73 total )  |  Next  |  Last  >>

Jump to: