Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kJ/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human)) | BDBM50238243 (CHEMBL4097165) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | 6 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company Curated by ChEMBL | Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay | J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
A disintegrin and metalloproteinase with thrombospondin motifs 4 (Homo sapiens (Human)) | BDBM50238243 (CHEMBL4097165) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | 6 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company Curated by ChEMBL | Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay | J Med Chem 59: 5810-22 (2016) Article DOI: 10.1021/acs.jmedchem.6b00398 BindingDB Entry DOI: 10.7270/Q280563T | |||||||||||
More data for this Ligand-Target Pair |