new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Major Urinary Protein (MUP-1)
Syringe Reactant:BDBM12031
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:11/12/06
 
ΔG°:-38.5±0.110 (kJ/mole)
pH:7.4±n/a
Log10Kb:6.52± n/a
Temperature:308±n/a (K)
ΔH° :n/a
ΔHobs :-47.9±0.860 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:1.01
ΔS° : -0.0305±0.00280 (kJ/mole-K)
Comments:n/a
 
Citation Bingham RJFindlay JBHsieh SYKalverda APKjellberg APerazzolo CPhillips SESeshadri KTrinh CHTurnbull WBBodenhausen GHomans SW Thermodynamics of Binding of 2-Methoxy-3-isopropylpyrazine and 2-Methoxy-3-isobutylpyrazine to the Major Urinary Protein J Am Chem Soc 126:1675-1681 (2004)    Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Major Urinary Protein (MUP-1)
Source:The MUP-1 gene was cloned and expressed in E. coli cells.
Purity:n/a
Prep. Method:MUP-I was purified using Ni-NTA resin. To remove endogenous bound ligands, an ethanol precipitation step was utilized involving addition of 2 volumes of absolute ethanol per volume of protein solution, followed by incubation at 4 °C for 2 h. After centrifugation at 5000g, the pellet was lyophilised, resuspended in PBS pH 7.4, and dialyzed overnight against the same buffer.
Name:Major Urinary Protein (MUP-1)
Synonyms:Major urinary protein 1 precursor
Type:Other Protein Type
Mol. Mass.:20640.17
Organism:Mus musculus (mouse)
Description:n/a
Residue:180
Sequence:
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL
EQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLM
AHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12031
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM12031
Synonyms:2-ISOBUTYL-3-METHOXYPYRAZINE | 2-methoxy-3-(2-methylpropyl)pyrazine | IBMP
TypeSmall organic molecule
Emp. Form.C9H14N2O
Mol. Mass.166.2203
SMILESCOc1nccnc1CC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.