new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:BirA Bifunctional Protein
Syringe Reactant:BDBM19478
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:12/19/07
 
ΔG°:-13.9±0.400 (kcal/mole)
pH:7.5±0.2
Log10Kb:10.4± 10.1
Temperature:293.15±0.1 (K)
ΔH° :n/a
ΔHobs :-12.3±0.900 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0.0100±0 (kcal/mole-K)
Comments:n/a
 
Citation Brown PHBeckett D Use of binding enthalpy to drive an allosteric transition. Biochemistry 44:3112-21 (2005) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
BirA Bifunctional Protein
Source:The BirA variants were expressed in the Escherichia coli strain JM109 transformed with the plasmid pBtac2 carrying the E. coli birA gene (wild-type or mutant) under transcriptional control of the tac
Purity:>95%
Prep. Method:The separation and purification of BirA from other cellular proteins was carried out in NiNTA column and Sepharose chromatography steps.
Name:BirA Bifunctional Protein
Synonyms:Biotin operon repressor | Biotin protein ligase (BPL) | Biotin--[acetyl-CoA-carboxylase] synthetase
Type:Repressor protein
Mol. Mass.:35313.58
Organism:Escherichia coli
Description:n/a
Residue:321
Sequence:
MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSL
PEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRG
RKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ
DRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAA
MLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLL
EQDGIIKPWMGGEISLRSAEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19478
Source:Synthesized and purified in the laboratory.
Purity:n/a
Prep. Method:n/a
NameBDBM19478
Synonyms:BTX | bio-5-AMP | biotinyl-5-AMP | {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}({5-[(4S)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazolidin-4-yl]pentanoyl}oxy)phosphinic acid
TypeNucleoside or nucleotide
Emp. Form.C20H28N7O9PS
Mol. Mass.573.517
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OC(=O)CCCC[C@@H]2SCC3NC(=O)NC23)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.