| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor type 1B |
|---|
| Ligand | BDBM463445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Ki | 11.0±n/a nM |
|---|
| Citation |  Ruch Werneck Guimarães, C; Felype Zaneti De Azevedo, H; Mascarello, A; Watanabe Da Costa, R; Freire Torres Russo, V; Mannochio De Souza Russo, E Compounds, process for obtaining the compounds, pharmaceutical composition, use of the compounds and method for treating psychiatric disorders and/or sleep disorders US Patent US11091445 Publication Date 8/17/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melatonin receptor type 1B |
|---|
| Name: | Melatonin receptor type 1B |
|---|
| Synonyms: | MTNR1B | MTR1B_HUMAN | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40203.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49286 |
|---|
| Residue: | 362 |
|---|
| Sequence: | MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
|
|
|
|---|
| BDBM463445 |
|---|
| n/a |
|---|
| Name | BDBM463445 |
|---|
| Synonyms: | US10781182, Compound IA2-140 | US11091445, Compound code IA2-140 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H19N3O3 |
|---|
| Mol. Mass. | 277.319 |
|---|
| SMILES | COc1nc2ccc(OC)cc2n1CCCNC(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
