| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM517738 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FPR2 and FPR1 Cyclic Adenosine Monophosphate (cAMP) Assays |
|---|
| EC50 | 675±n/a nM |
|---|
| Citation |  Shirude, PS; Chattopadhyay, AK; Wurtz, NR Aryl heterocyclic piperidinone formyl peptide 2 receptor and formyl peptide 1 receptor agonists US Patent US11124494 Publication Date 9/21/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM517738 |
|---|
| n/a |
|---|
| Name | BDBM517738 |
|---|
| Synonyms: | (R)-1-(1-(4-(1- ((dimethylamino) methyl)cyclopropyl) phenyl)-2- oxopiperidin-3-yl)- 3-(6- (trifluoromethyl) pyridin-3-yl)urea | US11124494, Example 67 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28F3N5O2 |
|---|
| Mol. Mass. | 475.5066 |
|---|
| SMILES | CN(C)CC1(CC1)c1ccc(cc1)N1CCC[C@@H](NC(=O)Nc2ccc(nc2)C(F)(F)F)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
