Reaction Details |
| Report a problem with these data |
Target | Estrogen receptor [298-554] |
---|
Ligand | BDBM521298 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biochemical Antagonist Activity on Wild Type (WT) and Mutants |
---|
IC50 | 3.00±n/a nM |
---|
Citation | Bouaboula, M; Brollo, M; Certal, V; El-Ahmad, Y; Filoche-Romme, B; Halley, F; McCort, G; Schio, L; Tabart, M; Terrier, C; Thompson, F Substituted N-(3-fluoropropyl)-pyrrolidine compounds, processes for their preparation and therapeutic uses thereof US Patent US11149031 Publication Date 10/19/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Estrogen receptor [298-554] |
---|
Name: | Estrogen receptor [298-554] |
Synonyms: | ESR | ESR1 | ESR1_HUMAN | Estrogen Receptor alpha (aa 298-554) | NR3A1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 29227.65 |
Organism: | Homo sapiens (Human) |
Description: | P03372[298-554] |
Residue: | 256 |
Sequence: | KRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMI
NWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCV
EGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRV
LDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYD
LLLEMLDAHRLHAPTS
|
|
|
BDBM521298 |
---|
n/a |
---|
Name | BDBM521298 |
Synonyms: | 4-(2,3- dimethylphenyl)- 5-[4-[(3S)-1-(3- fluoropropyl)pyr- rolidin-3- yl]oxyphenyl]- 2,3-dihydro-1- benzoxepin-8- ol | US11149031, Example 122 |
Type | Small organic molecule |
Emp. Form. | C31H34FNO3 |
Mol. Mass. | 487.605 |
SMILES | Cc1cccc(c1C)C1=C(c2ccc(O[C@H]3CCN(CCCF)C3)cc2)c2ccc(O)cc2OCC1 |r,c:9| |
Structure |
|