| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death 1 ligand 1 [19-239] |
|---|
| Ligand | BDBM304278 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Homogenous Time-Resolved Fluorescence (HTRF) Binding Assay |
|---|
| IC50 | 993±n/a nM |
|---|
| Citation |  Allen, MP; Gillis, EP; Langley, DR; Miller, MM; Mull, E; Sun, L; Yeung, K; Grant-Young, KA; Meanwell, NA; Scola, PM Immunomodulators US Patent US10143746 Publication Date 12/4/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death 1 ligand 1 [19-239] |
|---|
| Name: | Programmed cell death 1 ligand 1 [19-239] |
|---|
| Synonyms: | B7H1 | CD274 | Human PD-L1(aa 19-239)-TVMV-His | PD-L1-His | PD1L1_HUMAN | PDCD1L1 | PDCD1LG1 | PDL1 | hPDL1(aa 19-239)-TVMV-His |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27167.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9NZQ7[19-239] |
|---|
| Residue: | 237 |
|---|
| Sequence: | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQH
SSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKIN
QRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLR
INTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTGSSETVRFQGHHHHHH
|
|
|
|---|
| BDBM304278 |
|---|
| n/a |
|---|
| Name | BDBM304278 |
|---|
| Synonyms: | US10143746, Example 1503 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C89H122N20O19S |
|---|
| Mol. Mass. | 1808.109 |
|---|
| SMILES | CCCC[C@@H]1N(C)C(=O)[C@H](CCCC)N(C)C(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CO)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H]2CCNCC(=O)CNC(=O)[C@H](CSCC(=O)N[C@@H](Cc3ccc(O)cc3)C(=O)N(C)[C@@H](C)C(=O)C[C@@H](CC(N)=O)C(=O)N3CCC[C@H]3C(=O)N[C@@H](Cc3cnc[nH]3)C(=O)N[C@@H](CC(C)C)C(=O)N2)NC(=O)[C@H](C)NC1=O |r,$;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;HN;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;$| |
|---|
| Structure | 
|
|---|
Search and Browse
