| Reaction Details |
|---|
 | Report a problem with these data |
| Target | von Hippel-Lindau disease tumor suppressor |
|---|
| Ligand | BDBM536183 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | VHL HEK-293 BRET Assay |
|---|
| IC50 | 5480±n/a nM |
|---|
| Citation |  Blaquiere, N; Dragovich, P; Gazzard, LJ; Pillow, T; Staben, ST; Wei, B; Xin, J (4-hydroxypyrrolidin-2-yl)-heterocyclic compounds and methods of use thereof US Patent US11242344 Publication Date 2/8/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| von Hippel-Lindau disease tumor suppressor |
|---|
| Name: | von Hippel-Lindau disease tumor suppressor |
|---|
| Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24136.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P40337 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
|---|
| BDBM536183 |
|---|
| n/a |
|---|
| Name | BDBM536183 |
|---|
| Synonyms: | 2-((2S)-1-((4R)-4-hydroxy-2-((S)-5-methyl-5-(4-(4-methylthiazol-5-yl)phenyl)-4-oxo-4,5-dihydro-1H-imidazol-2-yl)pyrrolidin-1-yl)-3-methyl-1-oxobutan-2-yl)isoindolin-1-one | US11242344, Example 123.1 | US11242344, Example 123.2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33N5O4S |
|---|
| Mol. Mass. | 571.69 |
|---|
| SMILES | CC(C)[C@H](N1Cc2ccccc2C1=O)C(=O)N1C[C@H](O)CC1C1=NC(=O)[C@@](C)(N1)c1ccc(cc1)-c1scnc1C |r,t:25| |
|---|
| Structure | 
|
|---|
Search and Browse
