Reaction Details |
| Report a problem with these data |
Target | von Hippel-Lindau disease tumor suppressor |
---|
Ligand | BDBM536231 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | VHL HEK-293 BRET Assay |
---|
IC50 | 16200±n/a nM |
---|
Citation | Blaquiere, N; Dragovich, P; Gazzard, LJ; Pillow, T; Staben, ST; Wei, B; Xin, J (4-hydroxypyrrolidin-2-yl)-heterocyclic compounds and methods of use thereof US Patent US11242344 Publication Date 2/8/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
von Hippel-Lindau disease tumor suppressor |
---|
Name: | von Hippel-Lindau disease tumor suppressor |
Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
Type: | Protein |
Mol. Mass.: | 24136.87 |
Organism: | Homo sapiens (Human) |
Description: | P40337 |
Residue: | 213 |
Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
BDBM536231 |
---|
n/a |
---|
Name | BDBM536231 |
Synonyms: | (2R)-1-((2S,4R)-2-(2,3-dihydro-4'H-spiro[indene-1,5'-[1,2,4]oxadiazol]-3'-yl)-4-hydroxypyrrolidin-1-yl)-3-methyl-2-(3-methylisoxazol-5-yl)butan-1-one | US11242344, Example 130.3 | US11242344, Example 130.4 |
Type | Small organic molecule |
Emp. Form. | C23H28N4O4 |
Mol. Mass. | 424.4928 |
SMILES | CC(C)[C@@H](C(=O)N1C[C@H](O)C[C@H]1C1=NOC2(CCc3ccccc23)N1)c1cc(C)no1 |r,t:13| |
Structure |
|