| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
|---|
| Ligand | BDBM536452 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | BCL6-BTB-SMRT Peptide Inhibition Fluorescence Polarization (FP) Screen |
|---|
| Kd | 141±n/a nM |
|---|
| Citation |  Al-awar, R; Isaac, M; Chau, AM; Mamai, A; Watson, I; Poda, G; Subramanian, P; Wilson, B; Uehling, D Tricyclic inhibitors of the BCL6 BTB domain protein-protein interaction and uses thereof US Patent US11242351 Publication Date 2/8/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
|---|
| Name: | B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
|---|
| Synonyms: | BCL6-BTB domain and SMRT/NCOR2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | B-cell lymphoma 6 protein [1-129] |
|---|
| Synonyms: | BCL5 | BCL6 | BCL6_HUMAN | BCoR-BCL6 (aa 1-129) | LAZ3 | ZBTB27 | ZNF51 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14696.53 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | P41182[1-129] |
|---|
| Residue: | 129 |
|---|
| Sequence: | MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASE
|
|
|
|---|
| Component 2 |
| Name: | Nuclear receptor corepressor 2 [1414-1429] |
|---|
| Synonyms: | CTG26 | NCOR2 | NCOR2_HUMAN | Nuclear receptor corepressor 2 (aa 1414-1429) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 1720.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y618[1414-1429] |
|---|
| Residue: | 16 |
|---|
| Sequence: | |
|---|
| BDBM536452 |
|---|
| n/a |
|---|
| Name | BDBM536452 |
|---|
| Synonyms: | 5-(1-(2-((2-chloro-5- morpholinophenyl) amino)-2-oxoethyl)-4- oxo-4,6,7,8-tetrahydro- 1H-dipyrrolo[1,2-a:2',3'- d]pyrimidin-3-yl)-3,4- difluoro-2-hydroxy- benzamide | US11242351, Compound I-31 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H25ClF2N6O5 |
|---|
| Mol. Mass. | 598.985 |
|---|
| SMILES | NC(=O)c1cc(-c2cn(CC(=O)Nc3cc(ccc3Cl)N3CCOCC3)c3nc4CCCn4c(=O)c23)c(F)c(F)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
