Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
---|
Ligand | BDBM536470 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | BCL6-BTB-SMRT Peptide Inhibition Fluorescence Polarization (FP) Screen |
---|
Kd | 46.6±n/a nM |
---|
Citation | Al-awar, R; Isaac, M; Chau, AM; Mamai, A; Watson, I; Poda, G; Subramanian, P; Wilson, B; Uehling, D Tricyclic inhibitors of the BCL6 BTB domain protein-protein interaction and uses thereof US Patent US11242351 Publication Date 2/8/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
---|
Name: | B-cell lymphoma 6 protein [1-129]/Nuclear receptor corepressor 2 [1414-1429] |
Synonyms: | BCL6-BTB domain and SMRT/NCOR2 |
Type: | Protein |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | B-cell lymphoma 6 protein [1-129] |
Synonyms: | BCL5 | BCL6 | BCL6_HUMAN | BCoR-BCL6 (aa 1-129) | LAZ3 | ZBTB27 | ZNF51 |
Type: | PROTEIN |
Mol. Mass.: | 14696.53 |
Organism: | Homo sapiens |
Description: | P41182[1-129] |
Residue: | 129 |
Sequence: | MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASE
|
|
|
Component 2 |
Name: | Nuclear receptor corepressor 2 [1414-1429] |
Synonyms: | CTG26 | NCOR2 | NCOR2_HUMAN | Nuclear receptor corepressor 2 (aa 1414-1429) |
Type: | Enzyme |
Mol. Mass.: | 1720.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y618[1414-1429] |
Residue: | 16 |
Sequence: | |
BDBM536470 |
---|
n/a |
---|
Name | BDBM536470 |
Synonyms: | (S)-5-(1-(2-((3-chloro- 6-(2,4-dimethyl- piperazin-1-yl)-2- fluoropyridin-4-yl) amino)-2-oxoethyl)-4- oxo-4,6,7,8,9,10- hexahydro-1H-pyrrolo [2',3':4,5]pyrimido [1,2-a]azepin-3-yl)- 3,4-difluoro-2-hydroxy- benzamide | US11242351, Compound I-49 | acsmedchemlett.2c00502 OICR 13231D, 60 |
Type | Small organic molecule |
Emp. Form. | C31H32ClF3N8O4 |
Mol. Mass. | 673.085 |
SMILES | C[C@H]1CN(C)CCN1c1cc(NC(=O)Cn2cc(-c3cc(C(N)=O)c(O)c(F)c3F)c3c2nc2CCCCCn2c3=O)c(Cl)c(F)n1 |r| |
Structure |
|