Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl2-associated agonist of cell death |
---|
Ligand | BDBM50270877 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Homogeneous Time Resolved Fluorescence (HTRF) Assay |
---|
IC50 | <10±n/a nM |
---|
Citation | Pinchman, JR; Huang, PQ; Bunker, KD; Sit, RK; Samatar, AA Benzamide compounds US Patent US11344546 Publication Date 5/31/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl2-associated agonist of cell death |
---|
Name: | Bcl2-associated agonist of cell death |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
Type: | PROTEIN |
Mol. Mass.: | 18393.69 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_478760 |
Residue: | 168 |
Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
BDBM50270877 |
---|
n/a |
---|
Name | BDBM50270877 |
Synonyms: | (R)-4-(4-((2-(4-chlorophenyl)-5,5-dimethylcyclohex-1-enyl)methyl)piperazin-1-yl)-N-(4-(4-morpholino-1-(phenylthio)butan-2-ylamino)-3-(trifluoromethylsulfonyl)phenylsulfonyl)benzamide | ABT-263 | CHEMBL443684 | US11318134, Example ABT-263 | US11344546, Example ABT-263 | US11420968, Example ABT-263 | US11590126, Example ABT-263 |
Type | Small organic molecule |
Emp. Form. | C47H55ClF3N5O6S3 |
Mol. Mass. | 974.613 |
SMILES | CC1(C)CCC(=C(CN2CCN(CC2)c2ccc(cc2)C(=O)NS(=O)(=O)c2ccc(N[C@H](CCN3CCOCC3)CSc3ccccc3)c(c2)S(=O)(=O)C(F)(F)F)C1)c1ccc(Cl)cc1 |r,t:5| |
Structure |
|