| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase type 2 |
|---|
| Ligand | BDBM574742 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | metallo-beta-lactamase inhibition assay |
|---|
| IC50 | 2574±n/a nM |
|---|
| Citation |  Cooper, I; Orr, D; Wilkinson, A; Finlayson, J; Bunt, A; Appelqvist, P; Wallberg, H; Wångsell, F Antibacterial compounds US Patent US11459296 Publication Date 10/4/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase type 2 |
|---|
| Name: | Metallo-beta-lactamase type 2 |
|---|
| Synonyms: | B2 metallo-beta-lactamase | BLAN1_KLEPN | Beta-lactamase NDM-1 | Beta-lactamase type II | Metallo-beta-lactamase NDM-1 | Metallo-beta-lactamase type 2 | Metallo-beta-lactamase type II | NDM-1 | New Delhi metallo-beta-lactamase-1 | blaNDM-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28498.15 |
|---|
| Organism: | Klebsiella pneumoniae |
|---|
| Description: | ChEMBL_103887 |
|---|
| Residue: | 270 |
|---|
| Sequence: | MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH
AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF
PKASMIVMSHSAPDSRAAITHTARMADKLR
|
|
|
|---|
| BDBM574742 |
|---|
| n/a |
|---|
| Name | BDBM574742 |
|---|
| Synonyms: | (sodium salt): 3-Pyrrol-1-yl-1-sulfamoyl-pyrrole-2-carboxylic acid, Sodium Salt | US11459296, Example 73 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H8N3O4S |
|---|
| Mol. Mass. | 254.243 |
|---|
| SMILES | NS(=O)(=O)n1ccc(c1C([O-])=O)-n1cccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
