| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM552908 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Bcl-2 Protein Family Binding Assay |
|---|
| Kd | >100±n/a nM |
|---|
| Citation |  Pinchman, JR; Huang, PQ; Bunker, KD; Sit, RK; Samatar, AA Benzamide compounds US Patent US11590126 Publication Date 2/28/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM552908 |
|---|
| n/a |
|---|
| Name | BDBM552908 |
|---|
| Synonyms: | 2-(1H-pyrrolo[2,3-b]pyridin-5-yloxy)-4-(4-((2-(3-fluorobicyclo[1.1.1]pentan-1-yl)-4,4-dimethylcyclohex-1-enyl)methyl)piperazin-1-yl)-N-(3-nitro-4-((tetrahydro-2H-pyran-4-yl)methylamino)phenylsulfonyl)benzamide | US11318134, Example 10 | US11344546, Example 10 | US11590126, Example 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H52FN7O7S |
|---|
| Mol. Mass. | 841.99 |
|---|
| SMILES | CC1(C)CCC(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc4[nH]ccc4c3)c2)=C(C1)C12CC(F)(C1)C2 |c:57| |
|---|
| Structure | 
|
|---|
Search and Browse
