Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Retinol-binding protein 4 |
---|
Ligand | BDBM249464 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | TR-FRET Assay for Retinol-Induced RBP4-TTR Interaction |
---|
IC50 | 16.0±n/a nM |
---|
Citation | Petrukhin, K; Cioffi, C; Johnson, G; Allikmets, R; Freeman, E; Chen, P; Conlon, M; Zhu, L Substituted 4-phenylpiperidines, their preparation and use US Patent US11649240 Publication Date 5/16/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinol-binding protein 4 |
---|
Name: | Retinol-binding protein 4 |
Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
Type: | Protein |
Mol. Mass.: | 23008.75 |
Organism: | Homo sapiens (Human) |
Description: | P02753 |
Residue: | 201 |
Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
BDBM249464 |
---|
n/a |
---|
Name | BDBM249464 |
Synonyms: | US10072016, Compound 63 | US10407433, Compound 63 | US10913746, Compound 63 | US11649240, Compound 63 | US9434727, 63 | US9777010, Compound 63 |
Type | Small organic molecule |
Emp. Form. | C21H22F4N4O2 |
Mol. Mass. | 438.4186 |
SMILES | CC(=O)N1CCc2c(C1)[nH]nc2C(=O)N1CCC(CC1)c1cccc(F)c1C(F)(F)F |
Structure |
|