Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM321264 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay to Sigma Receptors |
---|
Ki | >1200±n/a nM |
---|
Citation | Melnyk, P; Vermersch, P; Carato, P; Oxombre-Vanteghem, B; Zephir, H; Donnier-Marechal, M Compounds, pharmaceutical composition and their use in treating neurodegenerative diseases US Patent US10179761 Publication Date 1/15/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM321264 |
---|
n/a |
---|
Name | BDBM321264 |
Synonyms: | N-[3-(benzylmethylamino)propyl]-2-chlorobenzamide | US10179761, Compound 3.1.7 |
Type | Small organic molecule |
Emp. Form. | C18H21ClN2O |
Mol. Mass. | 316.825 |
SMILES | CN(CCCNC(=O)c1ccccc1Cl)Cc1ccccc1 |
Structure |
|