| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chromatin remodeling regulator CECR2 [424-538] |
|---|
| Ligand | BDBM321453 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IC50 Measurements for Inhibitors Using TAF1-BD2 TR-FRET Binding Assay |
|---|
| IC50 | 640±n/a nM |
|---|
| Citation |  Albrecht, BK; Bellon, SF; Burdick, DJ; Cote, A; Crawford, T; Dakin, LA; Hsiao-Wei Tsui, V; Hewitt, MC; LeBlanc, Y; Magnuson, SR; Nasveschuk, CG; Romero, FA; Tang, Y; Taylor, AM; Wang, S Therapeutic compounds and uses thereof US Patent US10183009 Publication Date 1/22/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chromatin remodeling regulator CECR2 [424-538] |
|---|
| Name: | Chromatin remodeling regulator CECR2 [424-538] |
|---|
| Synonyms: | CECR2 | CECR2 (aa 424-538) | CECR2_HUMAN | Cat eye syndrome critical region protein 2 [424-538] | KIAA1740 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13747.10 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9BXF3[424-538] |
|---|
| Residue: | 115 |
|---|
| Sequence: | MREEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISS
MEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKH
|
|
|
|---|
| BDBM321453 |
|---|
| n/a |
|---|
| Name | BDBM321453 |
|---|
| Synonyms: | 3-(6-but-2-enyl-7-oxo-1H-pyrrolo[2,3-c]pyridin-4-yl)-N-methyl-benzamide | US10183009, Example 25 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H19N3O2 |
|---|
| Mol. Mass. | 321.3731 |
|---|
| SMILES | CNC(=O)c1cccc(c1)-c1cn(CC=CC)c(=O)c2[nH]ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
