Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50374596 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Receptor Assay |
---|
Ki | 2.44±0.26 nM |
---|
Citation | McCurdy, CR; Mesangeau, C; Chin, FT; James, ML; Shen, B; Gambhir, S; Biswal, S; Behera, D Highly selective sigma receptor ligands and radioligands as probes in nociceptive processing and the pathphysiological study of memory deficits and cognitive disorders US Patent US9724435 Publication Date 8/8/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50374596 |
---|
n/a |
---|
Name | BDBM50374596 |
Synonyms: | CHEMBL406081 | US9724435, Compound SN-99 |
Type | Small organic molecule |
Emp. Form. | C22H33N3OS |
Mol. Mass. | 387.582 |
SMILES | O=c1sc2ccccc2n1CCCCCN1CCN(CC1)C1CCCCC1 |
Structure |
|