Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Ligand | BDBM13208 |
---|
Substrate/Competitor | Smac-derived peptide |
---|
Meas. Tech. | Fluorescence Polarization Competitive Binding Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 22400±1870 nM |
---|
Citation | Sun, H; Nikolovska-Coleska, Z; Yang, CY; Xu, L; Tomita, Y; Krajewski, K; Roller, PP; Wang, S Structure-based design, synthesis, and evaluation of conformationally constrained mimetics of the second mitochondria-derived activator of caspase that target the X-linked inhibitor of apoptosis protein/caspase-9 interaction site. J Med Chem47:4147-50 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
Type: | Protein Binding Domain |
Mol. Mass.: | 13276.62 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 of XIAP: RESIDUES 241-356. |
Residue: | 116 |
Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
BDBM13208 |
---|
Smac-derived peptide |
---|
Name: | Smac-derived peptide |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 619.76 |
Organism: | n/a |
Description: | 5-carboxyfluorescein was coupled to
the lysine side chain of the mutated Smac peptide. |
Residue: | 5 |
Sequence: | |