| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Ligand | BDBM13600 |
|---|
| Substrate/Competitor | BDBM13594 |
|---|
| Meas. Tech. | PTP1B and TCPTP Inhibition Assay |
|---|
| pH | 6.3±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Scapin, G; Patel, SB; Becker, JW; Wang, Q; Desponts, C; Waddleton, D; Skorey, K; Cromlish, W; Bayly, C; Therien, M; Gauthier, JY; Li, CS; Lau, CK; Ramachandran, C; Kennedy, BP; Asante-Appiah, E The structural basis for the selectivity of benzotriazole inhibitors of PTP1B. Biochemistry42:11451-9 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34670.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
|---|
| BDBM13600 |
|---|
| BDBM13594 |
|---|
| Name | BDBM13600 |
|---|
| Synonyms: | 5-{4-[2-(1H-1,2,3-benzotriazol-1-yl)-3-{4-[difluoro(phosphono)methyl]phenyl}-2-phenylpropyl]phenyl}-2-methoxybenzene-1-phosphonic acid | Aryldifluoromethyl-Phosphonic Acid Inhibitor 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H31F2N3O7P2 |
|---|
| Mol. Mass. | 705.5809 |
|---|
| SMILES | COc1ccc(cc1P(O)(O)=O)-c1ccc(CC(Cc2ccc(cc2)C(F)(F)P(O)(O)=O)(c2ccccc2)n2nnc3ccccc23)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
