Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Retinol-binding protein 4 |
---|
Ligand | BDBM249482 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Scintillation Proximity Binding Assay |
---|
IC50 | 4.33±n/a nM |
---|
Citation | Petrukhin, K; Cioffi, C; Johnson, G; Allikmets, R; Freeman, E; Chen, P; Conlon, M; Zhu, L Substituted 4-phenylpiperidines, their preparation and use US Patent US9777010 Publication Date 10/3/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Retinol-binding protein 4 |
---|
Name: | Retinol-binding protein 4 |
Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
Type: | Protein |
Mol. Mass.: | 23008.75 |
Organism: | Homo sapiens (Human) |
Description: | P02753 |
Residue: | 201 |
Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
BDBM249482 |
---|
n/a |
---|
Name | BDBM249482 |
Synonyms: | US10072016, Compound 81 | US10407433, Compound 81 | US10913746, Compound 81 | US11649240, Compound 81 | US9434727, 80 | US9434727, 81 | US9777010, Compound 81 |
Type | Small organic molecule |
Emp. Form. | C21H21F5N4O2 |
Mol. Mass. | 456.4091 |
SMILES | CC(=O)N1CCc2c(C1)[nH]nc2C(=O)N1CCC(CC1)c1ccc(F)c(F)c1C(F)(F)F |
Structure |
|