Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM349521 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Competitive Radioligand Binding Assay 2 |
---|
Ki | 9.10±n/a nM |
---|
Citation | Rishton, GM; Catalano, SM; Look, GC Isoindoline compositions and methods for treating neurodegenerative disease US Patent US10207991 Publication Date 2/19/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM349521 |
---|
n/a |
---|
Name | BDBM349521 |
Synonyms: | US10207991, Ex. Cpd. No. 37 | US10611728, Example Compound 37 | US11691947, Example 37 |
Type | Small organic molecule |
Emp. Form. | C21H26FNO2 |
Mol. Mass. | 343.435 |
SMILES | CC(C)Oc1cc(CC[C@@H](C)N2Cc3ccc(F)cc3C2)ccc1O |r| |
Structure |
|