| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin K |
|---|
| Ligand | BDBM19547 |
|---|
| Substrate/Competitor | BDBM19583 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| Ki | 246±n/a nM |
|---|
| Citation |  Liu, H; Tully, DC; Epple, R; Bursulaya, B; Li, J; Harris, JL; Williams, JA; Russo, R; Tumanut, C; Roberts, MJ; Alper, PB; He, Y; Karanewsky, DS Design and synthesis of arylaminoethyl amides as noncovalent inhibitors of cathepsin S. Part 1. Bioorg Med Chem Lett15:4979-84 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cathepsin K |
|---|
| Name: | Cathepsin K |
|---|
| Synonyms: | CATK_HUMAN | CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36975.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43235 |
|---|
| Residue: | 329 |
|---|
| Sequence: | MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
|
|
|
|---|
| BDBM19547 |
|---|
| BDBM19583 |
|---|
| Name | BDBM19547 |
|---|
| Synonyms: | (2S)-N-{2-[(4-methoxyphenyl)amino]ethyl}-4,4-dimethyl-2-[(3-methylphenyl)formamido]pentanamide | arylaminoethyl amide, 5a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H33N3O3 |
|---|
| Mol. Mass. | 411.5371 |
|---|
| SMILES | COc1ccc(NCCNC(=O)[C@H](CC(C)(C)C)NC(=O)c2cccc(C)c2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
