Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM22563 |
---|
Substrate/Competitor | BDBM7966 |
---|
Meas. Tech. | Radioligand Binding Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 9±n/a nM |
---|
Citation | Lee-Dutra, A; Arienti, KL; Buzard, DJ; Hack, MD; Khatuya, H; Desai, PJ; Nguyen, S; Thurmond, RL; Karlsson, L; Edwards, JP; Breitenbucher, JG Identification of 2-arylbenzimidazoles as potent human histamine H4 receptor ligands. Bioorg Med Chem Lett16:6043-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM22563 |
---|
BDBM7966 |
---|
Name | BDBM22563 |
Synonyms: | 2-arylbenzimidazole derivative, 9 | 2-{2-chloro-4-[3-(4-methyl-1,4-diazepan-1-yl)propoxy]phenyl}-4,5-dimethyl-1H-1,3-benzodiazole |
Type | Small organic molecule |
Emp. Form. | C24H31ClN4O |
Mol. Mass. | 426.982 |
SMILES | CN1CCCN(CCCOc2ccc(-c3nc4ccc(C)c(C)c4[nH]3)c(Cl)c2)CC1 |
Structure |
|