Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM23709 |
---|
Substrate/Competitor | BDBM23699 |
---|
Meas. Tech. | Human Neutrophil Elastase Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 21±n/a nM |
---|
Citation | Schepetkin, IA; Khlebnikov, AI; Quinn, MT N-benzoylpyrazoles are novel small-molecule inhibitors of human neutrophil elastase. J Med Chem50:4928-38 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM23709 |
---|
BDBM23699 |
---|
Name | BDBM23709 |
Synonyms: | 3-methyl-1-[(3,4,5-trimethoxyphenyl)carbonyl]-1H-pyrazole | N-Benzoylpyrazole deriv., 17 |
Type | Small organic molecule |
Emp. Form. | C14H16N2O4 |
Mol. Mass. | 276.2878 |
SMILES | COc1cc(cc(OC)c1OC)C(=O)n1ccc(C)n1 |
Structure |
|