| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Epidermal growth factor receptor [696-1022,G719S] |
|---|
| Ligand | BDBM26105 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Fluorescence Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Kd | 11.3±1.5 nM |
|---|
| Citation |  Yun, CH; Boggon, TJ; Li, Y; Woo, MS; Greulich, H; Meyerson, M; Eck, MJ Structures of lung cancer-derived EGFR mutants and inhibitor complexes: mechanism of activation and insights into differential inhibitor sensitivity. Cancer Cell11:217-27 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Epidermal growth factor receptor [696-1022,G719S] |
|---|
| Name: | Epidermal growth factor receptor [696-1022,G719S] |
|---|
| Synonyms: | EGF-R Tyrosine Kinase Mutant (G719S) | EGFR | EGFR_HUMAN | ERBB | ERBB1 | HER1 |
|---|
| Type: | Tyrosine-protein kinase |
|---|
| Mol. Mass.: | 37282.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00533[696-1022,G719S] |
|---|
| Residue: | 327 |
|---|
| Sequence: | GEAPNQALLRILKETEFKKIKVLSSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKA
NKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLL
NWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK
VPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDS
NFYRALMDEEDMDDVVDADEYLIPQQG
|
|
|
|---|
| BDBM26105 |
|---|
| BDBM10852 |
|---|
| Name | BDBM26105 |
|---|
| Synonyms: | 6-{4-[(4-ethylpiperazin-1-yl)methyl]phenyl}-N-[(1R)-1-phenylethyl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine | AEE788 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H32N6 |
|---|
| Mol. Mass. | 440.5832 |
|---|
| SMILES | CCN1CCN(Cc2ccc(cc2)-c2cc3c(N[C@H](C)c4ccccc4)ncnc3[nH]2)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
