Reaction Details |
| Report a problem with these data |
Target | Epidermal growth factor receptor [696-1022,L858R] |
---|
Ligand | BDBM26105 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Fluorescence Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Kd | 1.7±.4 nM |
---|
Citation | Yun, CH; Boggon, TJ; Li, Y; Woo, MS; Greulich, H; Meyerson, M; Eck, MJ Structures of lung cancer-derived EGFR mutants and inhibitor complexes: mechanism of activation and insights into differential inhibitor sensitivity. Cancer Cell11:217-27 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Epidermal growth factor receptor [696-1022,L858R] |
---|
Name: | Epidermal growth factor receptor [696-1022,L858R] |
Synonyms: | EGF-R Tyrosine Kinase Mutant (L858R) | EGFR | EGFR_HUMAN | ERBB | ERBB1 | Epidermal growth factor receptor [696-1022,L858R] | HER1 | c-raf |
Type: | Tyrosine-protein kinase |
Mol. Mass.: | 37296.75 |
Organism: | Homo sapiens (Human) |
Description: | P00533[696-1022,L858R] |
Residue: | 327 |
Sequence: | GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKA
NKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLL
NWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGK
VPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDS
NFYRALMDEEDMDDVVDADEYLIPQQG
|
|
|
BDBM26105 |
---|
BDBM10852 |
---|
Name | BDBM26105 |
Synonyms: | 6-{4-[(4-ethylpiperazin-1-yl)methyl]phenyl}-N-[(1R)-1-phenylethyl]-7H-pyrrolo[2,3-d]pyrimidin-4-amine | AEE788 |
Type | Small organic molecule |
Emp. Form. | C27H32N6 |
Mol. Mass. | 440.5832 |
SMILES | CCN1CCN(Cc2ccc(cc2)-c2cc3c(N[C@H](C)c4ccccc4)ncnc3[nH]2)CC1 |r| |
Structure |
|