| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM387270 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of IL-2 secretion |
|---|
| IC50 | <100.0±n/a nM |
|---|
| Citation |  Irlapati, NR; Deshmukh, GK; Karche, VP; Jachak, SM; Sinha, N; Palle, VP; Kamboj, RK Oxazoline and isoxazoline derivatives as CRAC modulators US Patent US10292981 Publication Date 5/21/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM387270 |
|---|
| n/a |
|---|
| Name | BDBM387270 |
|---|
| Synonyms: | 2,6- Difluoro-N-(5-(2- methyl-5-(4- methyl-5-oxo-4,5- dihydro-1,3,4- oxadiazol-2- yl)phenyl)pyrazin- 2-yl)benzamide | US10292981, Example 87 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H15F2N5O3 |
|---|
| Mol. Mass. | 423.3723 |
|---|
| SMILES | Cc1ccc(cc1-c1cnc(NC(=O)c2c(F)cccc2F)cn1)-c1nn(C)c(=O)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
