| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM26623 |
|---|
| Substrate/Competitor | S6 kinase/Rsk-2 peptide 2 |
|---|
| Meas. Tech. | Pim Kinase Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 60±20 nM |
|---|
| Citation |  Xia, Z; Knaak, C; Ma, J; Beharry, ZM; McInnes, C; Wang, W; Kraft, AS; Smith, CD Synthesis and evaluation of novel inhibitors of Pim-1 and Pim-2 protein kinases. J Med Chem52:74-86 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM26623 |
|---|
| S6 kinase/Rsk-2 peptide 2 |
|---|
| Name: | S6 kinase/Rsk-2 peptide 2 |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1149.41 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 9 |
|---|
| Sequence: | |
|---|
Search and Browse
