Reaction Details |
| Report a problem with these data |
Target | Sortase family protein |
---|
Ligand | BDBM33333 |
---|
Substrate/Competitor | BDBM33299 |
---|
Meas. Tech. | Fluorescence Resonance Energy Transfer (FRET) Assay |
---|
IC50 | 3100±n/a nM |
---|
Citation | Suree, N; Yi, SW; Thieu, W; Marohn, M; Damoiseaux, R; Chan, A; Jung, ME; Clubb, RT Discovery and structure-activity relationship analysis of Staphylococcus aureus sortase A inhibitors. Bioorg Med Chem17:7174-85 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sortase family protein |
---|
Name: | Sortase family protein |
Synonyms: | Sortase | Sortase A (SrtA) |
Type: | Enzyme |
Mol. Mass.: | 23546.15 |
Organism: | Staphylococcus aureus |
Description: | n/a |
Residue: | 206 |
Sequence: | MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
LITCDDYNEKTGVWEKRKIFVATEVK
|
|
|
BDBM33333 |
---|
BDBM33299 |
---|
Name | BDBM33333 |
Synonyms: | pyridazinone, 2-20 |
Type | Small organic molecule |
Emp. Form. | C13H14N2O2S |
Mol. Mass. | 262.327 |
SMILES | CCOc1cnn(-c2cccc(C)c2)c(=O)c1S |
Structure |
|