| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Malignant T-cell-amplified sequence 1 |
|---|
| Ligand | BDBM403025 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | MTT assay |
|---|
| EC50 | 160±n/a nM |
|---|
| Citation |  Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL Heterocyclic inhibitors of monocarboxylate transporter US Patent US10329303 Publication Date 6/25/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Malignant T-cell-amplified sequence 1 |
|---|
| Name: | Malignant T-cell-amplified sequence 1 |
|---|
| Synonyms: | MCT-1 | MCT1 | MCTS1 | MCTS1_HUMAN | Multiple copies T-cell malignancies |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20563.62 |
|---|
| Organism: | Homo sapiens (human) |
|---|
| Description: | n/a |
|---|
| Residue: | 181 |
|---|
| Sequence: | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|
|
|---|
| BDBM403025 |
|---|
| n/a |
|---|
| Name | BDBM403025 |
|---|
| Synonyms: | US10329303, Example 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26F2N4O3S |
|---|
| Mol. Mass. | 488.55 |
|---|
| SMILES | CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3cc(F)c(F)c(CO)c3)c2c(=O)n(C)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
