Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Malignant T-cell-amplified sequence 1 |
---|
Ligand | BDBM403093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | MTT assay |
---|
EC50 | <20.0±n/a nM |
---|
Citation | Bannister, TD; Roush, WR; Choi, JY; Nair, R; Tsai, AS; Mishra, JK; Cleveland, JL Heterocyclic inhibitors of monocarboxylate transporter US Patent US10329303 Publication Date 6/25/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Malignant T-cell-amplified sequence 1 |
---|
Name: | Malignant T-cell-amplified sequence 1 |
Synonyms: | MCT-1 | MCT1 | MCTS1 | MCTS1_HUMAN | Multiple copies T-cell malignancies |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 20563.62 |
Organism: | Homo sapiens (human) |
Description: | n/a |
Residue: | 181 |
Sequence: | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|
|
BDBM403093 |
---|
n/a |
---|
Name | BDBM403093 |
Synonyms: | US10329303, Example 9 |
Type | Small organic molecule |
Emp. Form. | C24H27FN4O3S |
Mol. Mass. | 470.56 |
SMILES | CC(C)Cn1c2sc(Cc3c(C)n[nH]c3C)c(-c3ccc(F)c(CO)c3)c2c(=O)n(C)c1=O |
Structure |
|