| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM1102 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| Ki | 0.15±n/a nM |
|---|
| Citation |  De Lucca, GV; Liang, J; De Lucca, I Stereospecific synthesis, structure-activity relationship, and oral bioavailability of tetrahydropyrimidin-2-one HIV protease inhibitors. J Med Chem42:135-52 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM1102 |
|---|
| n/a |
|---|
| Name | BDBM1102 |
|---|
| Synonyms: | (4R,5R,6R)-Tetrahydro-1,3-bis[(3-carboxamidophenyl)methyl]-5-hydroxy-4-(2-(3,4-difluorophenyl)ethyl)-6-(3,4-difluorophenylmethyl)-2(1H)-pyrimidinone | 3-{[(4R,5R,6R)-3-[(3-carbamoylphenyl)methyl]-6-[2-(3,4-difluorophenyl)ethyl]-4-[(3,4-difluorophenyl)methyl]-5-hydroxy-2-oxo-1,3-diazinan-1-yl]methyl}benzamide | Tetrahydropyrimidinone deriv. 58 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H32F4N4O4 |
|---|
| Mol. Mass. | 648.6466 |
|---|
| SMILES | NC(=O)c1cccc(CN2[C@H](CCc3ccc(F)c(F)c3)[C@@H](O)[C@@H](Cc3ccc(F)c(F)c3)N(Cc3cccc(c3)C(N)=O)C2=O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
