Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Aldo-keto reductase family 1 member C3 |
---|
Ligand | BDBM264477 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | AKR1C3-Inhibitory Action |
---|
pH | 7±n/a |
---|
IC50 | 346±n/a nM |
---|
Comments | extracted |
---|
Citation | Bothe, U; Busemann, M; Barak, N; Rotgeri, A; Fischer, OM; Marquardt, T Estra-1,3,5(10),16-tetraene-3-carboxamides for inhibition of 17.beta.-hydroxysteroid dehydrogenase (AKR1C3) US Patent US9714266 Publication Date 7/25/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C3 |
---|
Name: | Aldo-keto reductase family 1 member C3 |
Synonyms: | 17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3) | 3-alpha-HSD type 2 | AK1C3_HUMAN | AKR1C3 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Aldo-keto-reductase family 1 member C3 | DDH1 | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | HSD17B5 | KIAA0119 | PGFS | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36859.86 |
Organism: | Homo sapiens (Human) |
Description: | P42330 |
Residue: | 323 |
Sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
|
|
|
BDBM264477 |
---|
n/a |
---|
Name | BDBM264477 |
Synonyms: | 3-{[(1,1,2,2,3,3,4,4,4-nonafluorobutyl)sulphonyl]oxy}-17-oxooestra-1,3,5(10)-trien-11a-yl acetate | US9714266, 6 |
Type | Small organic molecule |
Emp. Form. | C24H23F9O6S |
Mol. Mass. | 610.486 |
SMILES | [H][C@@]12CCC(=O)[C@@]1(C)C[C@@H](OC(C)=O)[C@]1([H])c3ccc(OS(=O)(=O)C(F)(F)C(F)(F)C(F)(F)C(F)(F)F)cc3CC[C@@]21[H] |r| |
Structure |
|