Reaction Details |
| Report a problem with these data |
Target | fMet-Leu-Phe receptor |
---|
Ligand | BDBM37848 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands |
---|
Ki | >43700±n/a nM |
---|
Citation | PubChem, PC Dose Response Assay for Formylpeptide Receptor (FPR) Ligands and Dose Response Counter-Screen Assay for Formylpeptide-Like-1 (FPRL1) Ligands PubChem Bioassay(2007)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
fMet-Leu-Phe receptor |
---|
Name: | fMet-Leu-Phe receptor |
Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38456.14 |
Organism: | Homo sapiens (Human) |
Description: | gi_4503779 |
Residue: | 350 |
Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
BDBM37848 |
---|
n/a |
---|
Name | BDBM37848 |
Synonyms: | 2-[[3-carbethoxy-4-(4-phenylphenyl)-2-thienyl]carbamoyl]-7-oxabicyclo[2.2.1]heptane-3-carboxylic acid | 2-[[3-ethoxycarbonyl-4-(4-phenylphenyl)thiophen-2-yl]carbamoyl]-7-oxabicyclo[2.2.1]heptane-3-carboxylic acid | 2-[[[3-ethoxycarbonyl-4-(4-phenylphenyl)-2-thiophenyl]amino]-oxomethyl]-7-oxabicyclo[2.2.1]heptane-3-carboxylic acid | 3-({[4-[1,1'-biphenyl]-4-yl-3-(ethoxycarbonyl)-2-thienyl]amino}carbonyl)-7-oxabicyclo[2.2.1]heptane-2-carboxylic acid | MLS000541097 | SMR000162191 | cid_3416015 |
Type | Small organic molecule |
Emp. Form. | C27H25NO6S |
Mol. Mass. | 491.556 |
SMILES | [H]C12CCC([H])(O1)C(C2C(O)=O)C(=O)Nc1scc(c1C(=O)OCC)-c1ccc(cc1)-c1ccccc1 |TLB:12:7:6:3.2,THB:9:8:6:3.2| |
Structure |
|