| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM403760 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of Tautomerase Activity of Human MIF |
|---|
| Ki | 370±n/a nM |
|---|
| Citation |  Jorgensen, WL; Dziedzic, P; Cisneros, J Biaryltriazole inhibitors of macrophage migration inhibitory factor US Patent US10336721 Publication Date 7/2/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM403760 |
|---|
| n/a |
|---|
| Name | BDBM403760 |
|---|
| Synonyms: | US10336721, Example 18 | US10968198, Example 18 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H16N4O2 |
|---|
| Mol. Mass. | 380.3987 |
|---|
| SMILES | Oc1ccc(cc1)-n1cc(nn1)-c1ccc2c(Oc3ccccc3)cccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
