Reaction Details |
| Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM39158 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | TR-FRET secondary assay for HTS discovery of chemical inhibitors of anti-apoptotic protein Bfl-1 |
---|
IC50 | 1950±70 nM |
---|
Citation | PubChem, PC TR-FRET secondary assay for HTS discovery of chemical inhibitors of anti-apoptotic protein Bfl-1 PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | A1 | A1-A | B-cell leukemia/lymphoma 2 related protein A1a | B2LA1_MOUSE | Bcl2a1 | Bcl2a1a | Bfl-1 | Bfl1 | Hemopoietic-specific early response protein | Protein BFL-1 |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 19909.74 |
Organism: | Mus musculus (Mouse) |
Description: | gi_11024684 |
Residue: | 172 |
Sequence: | MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
|
|
|
BDBM39158 |
---|
n/a |
---|
Name | BDBM39158 |
Synonyms: | 3-chloranyl-1-(3,4-dichlorophenyl)-4-(3-methylpiperazin-1-yl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(3-methyl-1-piperazinyl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(3-methylpiperazin-1-yl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(3-methylpiperazino)-3-pyrroline-2,5-quinone | MLS-0090876.0001 | cid_16654671 |
Type | Small organic molecule |
Emp. Form. | C15H14Cl3N3O2 |
Mol. Mass. | 374.65 |
SMILES | CC1CN(CCN1)C1=C(Cl)C(=O)N(C1=O)c1ccc(Cl)c(Cl)c1 |c:8| |
Structure |
|