Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM41592 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response Cell Based Assay for Antagonists of the S1P2 Receptor |
---|
IC50 | 1759±n/a nM |
---|
Citation | PubChem, PC Dose Response Cell Based Assay for Antagonists of the S1P2 Receptor PubChem Bioassay(2007)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM41592 |
---|
n/a |
---|
Name | BDBM41592 |
Synonyms: | (Z)-2,3-bis(chloranyl)-N-(6-methoxypyridin-3-yl)-3-(phenylmethyl)sulfonyl-prop-2-enamide | (Z)-2,3-dichloro-N-(6-methoxy-3-pyridinyl)-3-(phenylmethyl)sulfonyl-2-propenamide | (Z)-3-benzylsulfonyl-2,3-dichloro-N-(6-methoxy-3-pyridyl)acrylamide | (Z)-3-benzylsulfonyl-2,3-dichloro-N-(6-methoxypyridin-3-yl)prop-2-enamide | 3-(benzylsulfonyl)-2,3-dichloro-N-(6-methoxy-3-pyridinyl)acrylamide | MLS000540303 | SMR000125561 | cid_1472218 |
Type | Small organic molecule |
Emp. Form. | C16H14Cl2N2O4S |
Mol. Mass. | 401.264 |
SMILES | COc1ccc(NC(=O)C(\Cl)=C(\Cl)S(=O)(=O)Cc2ccccc2)cn1 |
Structure |
|