| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Ligand | BDBM43637 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response cell-based assay to measure STAT3 activation |
|---|
| IC50 | 4194±n/a nM |
|---|
| Citation |  PubChem, PC Dose response cell-based assay to measure STAT3 activation PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Name: | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Synonyms: | APRF | STAT3 | STAT3_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 5263.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_13272532 |
|---|
| Residue: | 50 |
|---|
| Sequence: | AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNGEGAEPSAGGQF
|
|
|
|---|
| BDBM43637 |
|---|
| n/a |
|---|
| Name | BDBM43637 |
|---|
| Synonyms: | 2-methyl-6-[1-(2-methylphenyl)-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbonyl]pyridazin-3-one | 2-methyl-6-[1-(o-tolyl)-1,3,4,9-tetrahydro-beta-carboline-2-carbonyl]pyridazin-3-one | 2-methyl-6-[[1-(2-methylphenyl)-1,3,4,9-tetrahydropyrido[3,4-b]indol-2-yl]-oxomethyl]-3-pyridazinone | 2-methyl-6-[[1-(2-methylphenyl)-1,3,4,9-tetrahydropyrido[3,4-b]indol-2-yl]carbonyl]pyridazin-3-one | 2-methyl-6-{[1-(2-methylphenyl)-1,3,4,9-tetrahydro-2H-beta-carbolin-2-yl]carbonyl}pyridazin-3(2H)-one | MLS000773203 | SMR000316991 | cid_16191466 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22N4O2 |
|---|
| Mol. Mass. | 398.4571 |
|---|
| SMILES | Cc1ccccc1C1N(CCc2c1[nH]c1ccccc21)C(=O)c1ccc(=O)n(C)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
