Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase Mu 1 |
---|
Ligand | BDBM32288 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays (HPSMTB buffer) |
---|
EC50 | 3160±n/a nM |
---|
Citation | PubChem, PC Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays (HPSMTB buffer) PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Glutathione S-transferase Mu 1 |
---|
Name: | Glutathione S-transferase Mu 1 |
Synonyms: | GST class-mu 1 | GST1 | GSTM1 | GSTM1-1 | GSTM1_HUMAN | GSTM1a-1a | GSTM1b-1b | GTH4 | Glutathione S-transferase Mu 1 | HB subunit 4 | glutathione S-transferase |
Type: | PROTEIN |
Mol. Mass.: | 25712.03 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_799596 |
Residue: | 218 |
Sequence: | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
|
|
|
BDBM32288 |
---|
n/a |
---|
Name | BDBM32288 |
Synonyms: | (1,1-diketo-1,2-benzothiazol-3-yl)-methyl-(4-pyridylmethyleneamino)amine | MLS000540072 | N-methyl-1,1-bis(oxidanylidene)-N-(pyridin-4-ylmethylideneamino)-1,2-benzothiazol-3-amine | N-methyl-1,1-dioxo-N-(pyridin-4-ylmethylideneamino)-1,2-benzothiazol-3-amine | SMR000162295 | cid_742063 | isonicotinaldehyde (1,1-dioxido-1,2-benzisothiazol-3-yl)(methyl)hydrazone |
Type | Small organic molecule |
Emp. Form. | C14H12N4O2S |
Mol. Mass. | 300.336 |
SMILES | CN(N=Cc1ccncc1)C1=NS(=O)(=O)c2ccccc12 |w:2.1,t:11| |
Structure |
|