| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 10 [11-204] |
|---|
| Ligand | BDBM32282 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. |
|---|
| EC50 | 1280±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 10 [11-204] |
|---|
| Name: | Bcl-2-like protein 10 [11-204] |
|---|
| Synonyms: | Apoptosis regulator Bcl-B (Bcl-2-like 10 protein) (Bcl2-L-10) (Anti-apoptotic protein NrH). | B2L10_HUMAN | BCL-B | BCL2L10 | BCLB | BOO | DIVA |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21981.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_23396469 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ
EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC
LLTTAFIYLWTRLL
|
|
|
|---|
| BDBM32282 |
|---|
| n/a |
|---|
| Name | BDBM32282 |
|---|
| Synonyms: | 2-[[2-amino-1-(3-ethoxypropyl)pyrrolo[3,2-b]quinoxaline-3-carbonyl]amino]-4,5,6,7-tetrahydrobenzothiophene-3-carboxylic acid methyl ester | 2-[[[2-amino-1-(3-ethoxypropyl)-3-pyrrolo[3,2-b]quinoxalinyl]-oxomethyl]amino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxylic acid methyl ester | 2-{[2-Amino-1-(3-ethoxy-propyl)-1H-pyrrolo[2,3-b]quinoxaline-3-carbonyl]-amino}-4,5,6,7-tetrahydro-be nzo[b]thiophene-3-carboxylic acid methyl ester | MLS000595324 | SMR000149847 | cid_1930774 | methyl 2-[[2-amino-1-(3-ethoxypropyl)pyrrolo[3,2-b]quinoxaline-3-carbonyl]amino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxylate | methyl 2-[[2-azanyl-1-(3-ethoxypropyl)pyrrolo[3,2-b]quinoxalin-3-yl]carbonylamino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H29N5O4S |
|---|
| Mol. Mass. | 507.605 |
|---|
| SMILES | CCOCCCn1c(N)c(C(=O)Nc2sc3CCCCc3c2C(=O)OC)c2nc3ccccc3nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
