| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Ligand | BDBM43534 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response counterscreen for STAT1 inhibitors: cell-based high throughput assay to measure STAT3 inhibition |
|---|
| IC50 | 23790±n/a nM |
|---|
| Citation |  PubChem, PC Dose response counterscreen for STAT1 inhibitors: cell-based high throughput assay to measure STAT3 inhibition PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Name: | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Synonyms: | APRF | STAT3 | STAT3_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 5263.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_13272532 |
|---|
| Residue: | 50 |
|---|
| Sequence: | AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNGEGAEPSAGGQF
|
|
|
|---|
| BDBM43534 |
|---|
| n/a |
|---|
| Name | BDBM43534 |
|---|
| Synonyms: | MLS000692834 | N-[[(Z)-2-bromanyl-3-phenyl-prop-2-enylidene]amino]-4-methyl-5-oxidanylidene-1,4-dihydropyrazole-3-carboxamide | N-[[(Z)-2-bromo-3-phenyl-prop-2-enylidene]amino]-5-keto-4-methyl-2-pyrazoline-3-carboxamide | N-[[(Z)-2-bromo-3-phenylprop-2-enylidene]amino]-4-methyl-5-oxo-1,4-dihydropyrazole-3-carboxamide | SMR000285172 | cid_16195082 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H13BrN4O2 |
|---|
| Mol. Mass. | 349.183 |
|---|
| SMILES | Cc1c([nH][nH]c1=O)C(=O)NN=CC(Br)=Cc1ccccc1 |w:10.10,14.15| |
|---|
| Structure | 
|
|---|
Search and Browse
