Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 8 |
---|
Ligand | BDBM47722 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. |
---|
EC50 | 9510±n/a nM |
---|
Citation | PubChem, PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 8 |
---|
Name: | Regulator of G-protein signaling 8 |
Synonyms: | RGS8 | RGS8_HUMAN | Regulator of G-protein signaling 8 (RGS8) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 20925.80 |
Organism: | Homo sapiens (Human) |
Description: | gi_74355113 |
Residue: | 180 |
Sequence: | MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
|
|
|
BDBM47722 |
---|
n/a |
---|
Name | BDBM47722 |
Synonyms: | 5-cyano-4-ethyl-2-methyl-N-phenyl-6-sulfanylidene-1H-pyridine-3-carboxamide | 5-cyano-4-ethyl-2-methyl-N-phenyl-6-thioxo-1,6-dihydro-3-pyridinecarboxamide | 5-cyano-4-ethyl-2-methyl-N-phenyl-6-thioxo-1H-pyridine-3-carboxamide | MLS000532290 | SMR000137229 | cid_789551 |
Type | Small organic molecule |
Emp. Form. | C16H15N3OS |
Mol. Mass. | 297.375 |
SMILES | CCc1c(C#N)c(=S)[nH]c(C)c1C(=O)Nc1ccccc1 |
Structure |
|