| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM46218 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR VHR1 Fluorescent Assay for In Vitro dose response studies |
|---|
| IC50 | >99000±n/a nM |
|---|
| Citation |  PubChem, PC SAR VHR1 Fluorescent Assay for In Vitro dose response studies PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM46218 |
|---|
| n/a |
|---|
| Name | BDBM46218 |
|---|
| Synonyms: | 2-(3-methyl-4-methylsulfanyl-phenoxy)ethanoic acid | 2-(3-methyl-4-methylsulfanylphenoxy)acetic acid | 2-[3-methyl-4-(methylthio)phenoxy]acetic acid | MLS-0412045.0001 | cid_823134 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12O3S |
|---|
| Mol. Mass. | 212.265 |
|---|
| SMILES | CSc1ccc(OCC(O)=O)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
