| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glycoprotein 42 |
|---|
| Ligand | BDBM51262 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus |
|---|
| IC50 | 910±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Glycoprotein 42 |
|---|
| Name: | Glycoprotein 42 |
|---|
| Synonyms: | BZLF2 | GP42_EBVA8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25424.12 |
|---|
| Organism: | Human herpesvirus 4 type 2 |
|---|
| Description: | gi_139424501 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPP
VNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYCNTREYTFSYKERCFYFTK
KKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGG
TFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
|
|
|
|---|
| BDBM51262 |
|---|
| n/a |
|---|
| Name | BDBM51262 |
|---|
| Synonyms: | 3-(1-benzofuran-2-carbonyl)-4-hydroxy-2-phenyl-1-(1,3-thiazol-2-yl)-2H-pyrrol-5-one | 3-(1-benzofuran-2-ylcarbonyl)-4-oxidanyl-2-phenyl-1-(1,3-thiazol-2-yl)-2H-pyrrol-5-one | 3-[2-benzofuranyl(oxo)methyl]-4-hydroxy-2-phenyl-1-(2-thiazolyl)-2H-pyrrol-5-one | 4-(Benzofuran-2-carbonyl)-3-hydroxy-5-phenyl-1-thiazol-2-yl-1,5-dihydro-pyrrol-2-one | 4-(benzofuran-2-carbonyl)-3-hydroxy-5-phenyl-1-thiazol-2-yl-3-pyrrolin-2-one | MLS000332351 | SMR000434941 | cid_3830309 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H14N2O4S |
|---|
| Mol. Mass. | 402.423 |
|---|
| SMILES | O=C(C1C(N(C(=O)C1=O)c1nccs1)c1ccccc1)c1cc2ccccc2o1 |
|---|
| Structure | 
|
|---|
Search and Browse
