| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM51976 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify epi-absorbance assay artifacts. |
|---|
| IC50 | 3255±n/a nM |
|---|
| Citation |  PubChem, PC FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify epi-absorbance assay artifacts. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Beta lactamase |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 31513.38 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | gi_114881106 |
|---|
| Residue: | 286 |
|---|
| Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
|
|
|
|---|
| BDBM51976 |
|---|
| n/a |
|---|
| Name | BDBM51976 |
|---|
| Synonyms: | 4-[(2-methyl-3-phenyl-2-propen-1-ylidene)amino]-5-(4-pyridinyl)-4H-1,2,4-triazole-3-thiol | 4-[[(Z)-2-methyl-3-phenyl-prop-2-enylidene]amino]-3-(4-pyridyl)-1H-1,2,4-triazole-5-thione | 4-[[(Z)-2-methyl-3-phenyl-prop-2-enylidene]amino]-3-pyridin-4-yl-1H-1,2,4-triazole-5-thione | 4-[[(Z)-2-methyl-3-phenylprop-2-enylidene]amino]-3-pyridin-4-yl-1H-1,2,4-triazole-5-thione | MLS000676258 | SMR000272003 | cid_895803 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15N5S |
|---|
| Mol. Mass. | 321.4 |
|---|
| SMILES | CC(C=Nn1c(n[nH]c1=S)-c1ccncc1)=Cc1ccccc1 |w:3.3,16.18| |
|---|
| Structure | 
|
|---|
Search and Browse
