| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM51943 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify inhibitors of IMP-1 metallo-beta-lactamase. |
|---|
| IC50 | 59640±n/a nM |
|---|
| Citation |  PubChem, PC FRET-based counterscreen for selective VIM-2 inhibitors: dose response biochemical high throughput screening assay to identify inhibitors of IMP-1 metallo-beta-lactamase. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Beta-lactamase | metallo-beta-lactamase IMP-1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27125.88 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | gi_27368096 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
|---|
| BDBM51943 |
|---|
| n/a |
|---|
| Name | BDBM51943 |
|---|
| Synonyms: | 2-Methoxy-N-(5-{[(thiophen-2-ylmethyl)-carbamoyl]-methylsulfanyl}-[1,3,4]thiadiazol-2-yl)-acetamide | 2-methoxy-N-[5-[2-oxidanylidene-2-(thiophen-2-ylmethylamino)ethyl]sulfanyl-1,3,4-thiadiazol-2-yl]ethanamide | 2-methoxy-N-[5-[2-oxo-2-(thiophen-2-ylmethylamino)ethyl]sulfanyl-1,3,4-thiadiazol-2-yl]acetamide | 2-methoxy-N-[5-[[2-oxo-2-(thiophen-2-ylmethylamino)ethyl]thio]-1,3,4-thiadiazol-2-yl]acetamide | MLS000033296 | N-[5-[[2-keto-2-(2-thenylamino)ethyl]thio]-1,3,4-thiadiazol-2-yl]-2-methoxy-acetamide | SMR000006626 | cid_655628 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H14N4O3S3 |
|---|
| Mol. Mass. | 358.46 |
|---|
| SMILES | COCC(=O)Nc1nnc(SCC(=O)NCc2cccs2)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
